PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA40145
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CO-like
Protein Properties Length: 309aa    MW: 34359.2 Da    PI: 6.4388
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA40145genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box30.48.2e-10446440
                   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                               + C+ +++ +++lfC++++ +lC +C +++H        H +v
  Tp57577_TGAC_v2_mRNA40145  4 KLCDSCKSAKATLFCRSDSAFLCITCDSNIHAAnklasrHHRV 46
                               57******99*********************667888885444 PP

2zf-B_box23.41.2e-074691342
                   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                                  C+ +e+ +++  C+ +   lC +C   +H+       H+++pl
  Tp57577_TGAC_v2_mRNA40145 46 VSLCEVCEQAPAHVTCKADAAALCVSCDHDIHSAnplarrHERIPL 91
                               568*****************************66889999999886 PP

3CCT70.63.8e-24247290144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                Rea+++RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Tp57577_TGAC_v2_mRNA40145 247 REARVMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRS 290
                                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.2E-12148IPR000315B-box-type zinc finger
PROSITE profilePS5011911.348148IPR000315B-box-type zinc finger
PfamPF006436.9E-7547IPR000315B-box-type zinc finger
CDDcd000215.91E-9548No hitNo description
PROSITE profilePS5011911.0214491IPR000315B-box-type zinc finger
PfamPF006433.5E-64791IPR000315B-box-type zinc finger
CDDcd000215.97E-74891No hitNo description
SMARTSM003364.3E-94991IPR000315B-box-type zinc finger
PfamPF062035.5E-18247289IPR010402CCT domain
PROSITE profilePS5101716.906247289IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MAIKLCDSCK SAKATLFCRS DSAFLCITCD SNIHAANKLA SRHHRVSLCE VCEQAPAHVT  60
CKADAAALCV SCDHDIHSAN PLARRHERIP LTTFHHHNNT EQQFFPESDP DADVSTEEAE  120
AASWLLQTPS NPKFPDLNAS HYSFNEIDAT DLDFVSVDTK TDLPEQQSPG TADGVVPVQS  180
QNKTATEHYS DINIDFSNSK PFTYSYNHNV SSPSMEVGIV PDGNTEISYC GYRSTATEAV  240
VMTAADREAR VMRYREKRKN RRFEKTIRYA SRKAYAETRP RIKGRFAKRS DLNVNLIAED  300
EYGVVPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498823.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T92e-97COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLQ52ZI70.0Q52ZI7_PEA; CONSTANS-LIKE b
STRINGGLYMA06G06300.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.15e-98CONSTANS-like 4